PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20358.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 202aa    MW: 23901.5 Da    PI: 4.4488
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20358.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-181964148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
        PK20358.2 19 RGNFTKEEEETIIELHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 64
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-10224IPR009057Homeodomain-like
SuperFamilySSF466894.18E-22271IPR009057Homeodomain-like
PROSITE profilePS5129426.1731468IPR017930Myb domain
SMARTSM007171.3E-151866IPR001005SANT/Myb domain
PfamPF002491.0E-161964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-242568IPR009057Homeodomain-like
CDDcd001674.43E-53364No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
XGKSCRLRWI NYLRPDIKRG NFTKEEEETI IELHQMLGNR WSAIAARLPG RTDNEIKNVW  60
HTHLKKRLII NNNDDVIIQK SKRQRNHESY DDDNIIKIDD TKYDNDNNSN DNLVVSSPLQ  120
SSSSYDSFIS TDDQKFSETM DDQFWTEVFS SESEDDHNNN SENHEFDFTL RSSNNNVDYD  180
QDMEFWFNVF TRSADLPELL LX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1926842108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17984KSKRQR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028802.12e-53PREDICTED: myb-related protein Myb4-like
TrEMBLB9GS151e-52B9GS15_POPTR; GmMYB29 family protein
STRINGPOPTR_0002s03960.14e-52(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.16e-42myb domain protein 13